PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.K5WSC
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB_related
Protein Properties Length: 266aa    MW: 29932.7 Da    PI: 9.4414
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.K5WSCgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.32.7e-1661102346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      ++ +eE+e+l+ a++++G++ W+ Iar ++ gRt++ +k++w+ 
      Aradu.K5WSC  61 AFCEEEEERLLTAHRMYGNK-WAMIARLFP-GRTDNAVKNHWHV 102
                      5669****************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.18E-2043110IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-64466IPR009057Homeodomain-like
PROSITE profilePS5129425.47554108IPR017930Myb domain
SMARTSM007171.5E-1258106IPR001005SANT/Myb domain
PfamPF002494.0E-1361101IPR001005SANT/Myb domain
CDDcd001671.95E-1064101No hitNo description
Gene3DG3DSA:1.10.10.602.5E-1667102IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MGLQILSSSK WKMGTNNNRK IGHVKLCARG HWRPAEDAQL KALSCRLRWF NQLDPRINRR  60
AFCEEEEERL LTAHRMYGNK WAMIARLFPG RTDNAVKNHW HVIMARKQRE QSSMYRRRKP  120
THVFSPPSVE EEGGVLLPPP KALELTLSSN NNNVASDDQL TISDESVSTE LTAPTSFFHK  180
IGEGVGGMNV GYEKFYGGWN NGKLKCVDQS NFSESNNSSS EVSVSESVGT TNRSYLSISG  240
ESENHNIRNK INNMPAFIDF LGVGAT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-184410744107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015970855.11e-171PREDICTED: myb-like protein A
TrEMBLA0A151TA384e-75A0A151TA38_CAJCA; Transcription factor MYB44
STRINGGLYMA03G00980.11e-73(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23034243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.16e-52myb domain protein 105